PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1979
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 301aa    MW: 33666.8 Da    PI: 5.978
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1979genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd++++ G g+W+ +++  g++R++k+c++rw +yl
      Gh_A03G1979 15 KGPWTAEEDQKLVDYINKNGHGSWRIVPKQAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.52.7e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+ l+++++  lG++ W++Ia++++ gRt++++k++w++
      Gh_A03G1979  68 RGKFSEEEERLIINLHSVLGNK-WSKIAAHLP-GRTDNEIKNFWNT 111
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-25765IPR009057Homeodomain-like
PROSITE profilePS5129419.6771062IPR017930Myb domain
SuperFamilySSF466893.06E-3212109IPR009057Homeodomain-like
SMARTSM007175.0E-151464IPR001005SANT/Myb domain
PfamPF002494.9E-171562IPR001005SANT/Myb domain
CDDcd001678.08E-111762No hitNo description
PROSITE profilePS5129427.72563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-2766117IPR009057Homeodomain-like
SMARTSM007171.6E-1667115IPR001005SANT/Myb domain
PfamPF002495.1E-1668111IPR001005SANT/Myb domain
CDDcd001673.04E-1270111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRSPSCADD ANVKKGPWTA EEDQKLVDYI NKNGHGSWRI VPKQAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEEEERLII NLHSVLGNKW SKIAAHLPGR TDNEIKNFWN TRIRRKLLNL  120
GIDPHTHKPR TDLDHLLNLS QLLCVAQLGN TMNPLDAAFK LQADAAQLAQ AQLFQNLMQI  180
MNTNKAANVE SDGFLALQEN TNPIPQSIPN NGFIAGVVPQ TSDPWGLSSS FEQRENPVLP  240
GLVSISPESN STMENKGNNE TDSTIYEAWE KLIMEDDEAD GGSYWKEMLD LASSTSSPIS  300
W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32151177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472676.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-80MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D2RPT20.0A0A0D2RPT2_G
STRINGGLYMA09G33870.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.17e-75myb domain protein 107